Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 92901..93544 | Replicon | plasmid P1 |
Accession | NZ_OW967967 | ||
Organism | Escherichia coli isolate 648 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | LQ127_RS25470 | Protein ID | WP_001044768.1 |
Coordinates | 93128..93544 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | LQ127_RS25465 | Protein ID | WP_001261287.1 |
Coordinates | 92901..93131 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ127_RS25455 (AI2858V1_4933) | 88079..89212 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
LQ127_RS25460 (AI2858V1_4934) | 89475..92594 | - | 3120 | WP_023909028.1 | hypothetical protein | - |
LQ127_RS25465 (AI2858V1_4935) | 92901..93131 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LQ127_RS25470 (AI2858V1_4936) | 93128..93544 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ127_RS25475 (AI2858V1_4937) | 93706..95844 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
LQ127_RS25480 (AI2858V1_4938) | 96309..97304 | + | 996 | WP_000246636.1 | hypothetical protein | - |
LQ127_RS25485 (AI2858V1_4939) | 97308..98240 | + | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / blaOXA-1 / aac(6')-Ib-cr / aadA5 / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / mph(A) / erm(B) | - | 1..107837 | 107837 | |
- | flank | IS/Tn | - | - | 98377..98880 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T295900 WP_001044768.1 NZ_OW967967:93128-93544 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |