Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 86422..86947 | Replicon | plasmid P1 |
Accession | NZ_OW967967 | ||
Organism | Escherichia coli isolate 648 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | LQ127_RS25435 | Protein ID | WP_001159868.1 |
Coordinates | 86422..86727 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A223LLB0 |
Locus tag | LQ127_RS25440 | Protein ID | WP_023909027.1 |
Coordinates | 86729..86947 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ127_RS25420 (AI2858V1_4926) | 82332..83498 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
LQ127_RS25425 (AI2858V1_4927) | 84086..84841 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
LQ127_RS25430 (AI2858V1_4928) | 85615..86421 | - | 807 | WP_000016982.1 | site-specific integrase | - |
LQ127_RS25435 (AI2858V1_4929) | 86422..86727 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
LQ127_RS25440 (AI2858V1_4930) | 86729..86947 | - | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
LQ127_RS25445 (AI2858V1_4931) | 87581..87778 | + | 198 | WP_000215657.1 | hypothetical protein | - |
LQ127_RS25450 (AI2858V1_4932) | 87775..88059 | - | 285 | WP_000642771.1 | hypothetical protein | - |
LQ127_RS25455 (AI2858V1_4933) | 88079..89212 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / blaOXA-1 / aac(6')-Ib-cr / aadA5 / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / mph(A) / erm(B) | - | 1..107837 | 107837 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T295899 WP_001159868.1 NZ_OW967967:c86727-86422 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|