Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4435926..4436521 | Replicon | chromosome |
| Accession | NZ_OW967966 | ||
| Organism | Escherichia coli isolate 648 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | LQ127_RS21685 | Protein ID | WP_000239581.1 |
| Coordinates | 4435926..4436276 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | LQ127_RS21690 | Protein ID | WP_001223213.1 |
| Coordinates | 4436270..4436521 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ127_RS21665 (4431380) | 4431380..4432402 | - | 1023 | WP_001298067.1 | ABC transporter permease | - |
| LQ127_RS21670 (4432416) | 4432416..4433918 | - | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
| LQ127_RS21675 (4434051) | 4434051..4435007 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| LQ127_RS21680 (4435317) | 4435317..4435847 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| LQ127_RS21685 (4435926) | 4435926..4436276 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| LQ127_RS21690 (4436270) | 4436270..4436521 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| LQ127_RS21695 (4436733) | 4436733..4437074 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| LQ127_RS21700 (4437077) | 4437077..4440856 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T295895 WP_000239581.1 NZ_OW967966:c4436276-4435926 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|