Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3352992..3353697 | Replicon | chromosome |
| Accession | NZ_OW967966 | ||
| Organism | Escherichia coli isolate 648 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | LQ127_RS16430 | Protein ID | WP_000539521.1 |
| Coordinates | 3352992..3353378 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LQ127_RS16435 | Protein ID | WP_001280945.1 |
| Coordinates | 3353368..3353697 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ127_RS16410 (3348996) | 3348996..3349622 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| LQ127_RS16415 (3349619) | 3349619..3350734 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
| LQ127_RS16420 (3350845) | 3350845..3351228 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| LQ127_RS16425 (3351441) | 3351441..3352766 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| LQ127_RS16430 (3352992) | 3352992..3353378 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ127_RS16435 (3353368) | 3353368..3353697 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| LQ127_RS16440 (3353767) | 3353767..3354180 | - | 414 | Protein_3242 | GGDEF domain-containing protein | - |
| LQ127_RS16445 (3354235) | 3354235..3354932 | + | 698 | WP_223216367.1 | IS1 family transposase | - |
| LQ127_RS16450 (3354939) | 3354939..3355871 | - | 933 | Protein_3244 | GGDEF domain-containing protein | - |
| LQ127_RS16455 (3355879) | 3355879..3358227 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | mdf(A) | - | 3307199..3358227 | 51028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T295890 WP_000539521.1 NZ_OW967966:3352992-3353378 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|