Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2639441..2640079 | Replicon | chromosome |
Accession | NZ_OW967966 | ||
Organism | Escherichia coli isolate 648 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | LQ127_RS12840 | Protein ID | WP_000813794.1 |
Coordinates | 2639903..2640079 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LQ127_RS12835 | Protein ID | WP_001270286.1 |
Coordinates | 2639441..2639857 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ127_RS12815 (2634593) | 2634593..2635534 | - | 942 | WP_022645667.1 | ABC transporter permease | - |
LQ127_RS12820 (2635535) | 2635535..2636548 | - | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
LQ127_RS12825 (2636566) | 2636566..2637711 | - | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
LQ127_RS12830 (2637956) | 2637956..2639362 | - | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
LQ127_RS12835 (2639441) | 2639441..2639857 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
LQ127_RS12840 (2639903) | 2639903..2640079 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
LQ127_RS12845 (2640301) | 2640301..2640531 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
LQ127_RS12850 (2640623) | 2640623..2642584 | - | 1962 | WP_023909195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
LQ127_RS12855 (2642657) | 2642657..2643193 | - | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
LQ127_RS12860 (2643285) | 2643285..2644457 | + | 1173 | WP_022645663.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T295888 WP_000813794.1 NZ_OW967966:c2640079-2639903 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT295888 WP_001270286.1 NZ_OW967966:c2639857-2639441 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|