Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2093934..2094766 | Replicon | chromosome |
| Accession | NZ_OW967966 | ||
| Organism | Escherichia coli isolate 648 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A646JIT5 |
| Locus tag | LQ127_RS10105 | Protein ID | WP_053290118.1 |
| Coordinates | 2093934..2094308 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A646JF77 |
| Locus tag | LQ127_RS10110 | Protein ID | WP_033873479.1 |
| Coordinates | 2094398..2094766 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ127_RS10075 (2089235) | 2089235..2089639 | + | 405 | WP_000839179.1 | transposase | - |
| LQ127_RS10080 (2089636) | 2089636..2089983 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ127_RS10085 (2090032) | 2090032..2091560 | + | 1529 | Protein_1983 | IS66-like element ISEc22 family transposase | - |
| LQ127_RS10090 (2091614) | 2091614..2093203 | + | 1590 | WP_110221327.1 | IS66-like element ISEc23 family transposase | - |
| LQ127_RS10095 (2093605) | 2093605..2093685 | - | 81 | Protein_1985 | hypothetical protein | - |
| LQ127_RS10100 (2093785) | 2093785..2093937 | - | 153 | Protein_1986 | DUF5983 family protein | - |
| LQ127_RS10105 (2093934) | 2093934..2094308 | - | 375 | WP_053290118.1 | TA system toxin CbtA family protein | Toxin |
| LQ127_RS10110 (2094398) | 2094398..2094766 | - | 369 | WP_033873479.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ127_RS10115 (2094929) | 2094929..2095150 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ127_RS10120 (2095213) | 2095213..2095689 | - | 477 | WP_001747787.1 | RadC family protein | - |
| LQ127_RS10125 (2095705) | 2095705..2096178 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| LQ127_RS10130 (2096520) | 2096520..2097338 | - | 819 | WP_001765427.1 | DUF932 domain-containing protein | - |
| LQ127_RS10135 (2097456) | 2097456..2097651 | - | 196 | Protein_1993 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14025.07 Da Isoelectric Point: 7.2127
>T295883 WP_053290118.1 NZ_OW967966:c2094308-2093934 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQYYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVSSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQYYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVSSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13620.45 Da Isoelectric Point: 6.6255
>AT295883 WP_033873479.1 NZ_OW967966:c2094766-2094398 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYVKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYVKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A646JIT5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A646JF77 |