Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 912252..913087 Replicon chromosome
Accession NZ_OW967966
Organism Escherichia coli isolate 648

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag LQ127_RS04350 Protein ID WP_001564063.1
Coordinates 912252..912629 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0A1AEL8
Locus tag LQ127_RS04355 Protein ID WP_038432125.1
Coordinates 912719..913087 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ127_RS04320 (907380) 907380..908528 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
LQ127_RS04325 (908600) 908600..909583 - 984 WP_001361242.1 KpsF/GutQ family sugar-phosphate isomerase -
LQ127_RS04330 (910394) 910394..910564 - 171 Protein_852 IS110 family transposase -
LQ127_RS04335 (910906) 910906..911748 - 843 Protein_853 DUF4942 domain-containing protein -
LQ127_RS04340 (911833) 911833..912027 - 195 WP_024181941.1 DUF957 domain-containing protein -
LQ127_RS04345 (912106) 912106..912255 - 150 Protein_855 DUF5983 family protein -
LQ127_RS04350 (912252) 912252..912629 - 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
LQ127_RS04355 (912719) 912719..913087 - 369 WP_038432125.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ127_RS04360 (913250) 913250..913471 - 222 WP_000692345.1 DUF987 domain-containing protein -
LQ127_RS04365 (913534) 913534..914010 - 477 WP_021553055.1 RadC family protein -
LQ127_RS04370 (914026) 914026..914505 - 480 WP_001564060.1 antirestriction protein -
LQ127_RS04375 (914771) 914771..915589 - 819 WP_001175165.1 DUF932 domain-containing protein -
LQ127_RS04380 (915679) 915679..915912 - 234 WP_001278293.1 DUF905 family protein -
LQ127_RS04385 (915918) 915918..916595 - 678 WP_001564058.1 hypothetical protein -
LQ127_RS04390 (916746) 916746..917426 - 681 WP_001278649.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 898079..946912 48833
- flank IS/Tn - - 910394..910549 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T295879 WP_001564063.1 NZ_OW967966:c912629-912252 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13569.31 Da        Isoelectric Point: 7.0369

>AT295879 WP_038432125.1 NZ_OW967966:c913087-912719 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0A1AEL8

References