Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 71240..72041 | Replicon | chromosome |
| Accession | NZ_OW967966 | ||
| Organism | Escherichia coli isolate 648 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A376QBB8 |
| Locus tag | LQ127_RS00300 | Protein ID | WP_038635535.1 |
| Coordinates | 71240..71617 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | LQ127_RS00305 | Protein ID | WP_089551113.1 |
| Coordinates | 71664..72041 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ127_RS00270 (66600) | 66600..67523 | - | 924 | WP_022646286.1 | carboxylate/amino acid/amine transporter | - |
| LQ127_RS00275 (67634) | 67634..68818 | - | 1185 | WP_001172866.1 | sugar efflux transporter | - |
| LQ127_RS00280 (69217) | 69217..69378 | - | 162 | Protein_55 | RhuM family protein | - |
| LQ127_RS00285 (69613) | 69613..70461 | - | 849 | WP_162676397.1 | DUF4942 domain-containing protein | - |
| LQ127_RS00290 (70546) | 70546..70743 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
| LQ127_RS00295 (70755) | 70755..71243 | - | 489 | WP_038635538.1 | DUF5983 family protein | - |
| LQ127_RS00300 (71240) | 71240..71617 | - | 378 | WP_038635535.1 | TA system toxin CbtA family protein | Toxin |
| LQ127_RS00305 (71664) | 71664..72041 | - | 378 | WP_089551113.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ127_RS00310 (72120) | 72120..72341 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| LQ127_RS00315 (72404) | 72404..72880 | - | 477 | WP_001747787.1 | RadC family protein | - |
| LQ127_RS00320 (72896) | 72896..73369 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| LQ127_RS00325 (73711) | 73711..74532 | - | 822 | WP_230139066.1 | DUF932 domain-containing protein | - |
| LQ127_RS00330 (74632) | 74632..74805 | - | 174 | WP_000088744.1 | DUF905 family protein | - |
| LQ127_RS00335 (74925) | 74925..75167 | - | 243 | WP_230139068.1 | DNA polymerase III subunit gamma/tau | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 59890..73369 | 13479 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14016.93 Da Isoelectric Point: 7.3223
>T295875 WP_038635535.1 NZ_OW967966:c71617-71240 [Escherichia coli]
MNTLPDTHVRETSGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVRETSGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13868.73 Da Isoelectric Point: 5.8746
>AT295875 WP_089551113.1 NZ_OW967966:c72041-71664 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLVDRAGIRGRFSDADAYHLDQAFLLLMKQLELMLTSG
ELNPRHQHTVTLYAKELTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLVDRAGIRGRFSDADAYHLDQAFLLLMKQLELMLTSG
ELNPRHQHTVTLYAKELTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|