Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2808889..2809733 Replicon chromosome
Accession NZ_OW967802
Organism Escherichia coli isolate 410

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag LQ147_RS13640 Protein ID WP_000854686.1
Coordinates 2808889..2809272 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag LQ147_RS13645 Protein ID WP_001285602.1
Coordinates 2809353..2809733 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ147_RS13600 (2803892) 2803892..2804383 - 492 WP_001297187.1 DUF1097 domain-containing protein -
LQ147_RS13605 (2804485) 2804485..2805039 - 555 WP_001001902.1 molecular chaperone YcdY -
LQ147_RS13610 (2805063) 2805063..2805800 - 738 WP_000283664.1 zinc-binding phosphatase -
LQ147_RS13615 (2805855) 2805855..2806793 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
LQ147_RS13625 (2807264) 2807264..2808105 - 842 Protein_2675 DUF4942 domain-containing protein -
LQ147_RS13630 (2808190) 2808190..2808387 - 198 WP_000839253.1 DUF957 domain-containing protein -
LQ147_RS13635 (2808404) 2808404..2808892 - 489 WP_032180032.1 DUF5983 family protein -
LQ147_RS13640 (2808889) 2808889..2809272 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
LQ147_RS13645 (2809353) 2809353..2809733 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ147_RS13650 (2809744) 2809744..2810427 - 684 WP_000086768.1 hypothetical protein -
LQ147_RS13655 (2810446) 2810446..2810667 - 222 WP_000692298.1 DUF987 domain-containing protein -
LQ147_RS13660 (2810730) 2810730..2811206 - 477 WP_001186726.1 RadC family protein -
LQ147_RS13665 (2811222) 2811222..2811707 - 486 WP_000214307.1 antirestriction protein -
LQ147_RS13670 (2811799) 2811799..2812620 - 822 WP_001761104.1 DUF932 domain-containing protein -
LQ147_RS13675 (2812721) 2812721..2812929 - 209 Protein_2685 DUF905 family protein -
LQ147_RS13680 (2813030) 2813030..2813485 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCMY-2 csgB / csgD / csgE / csgF / csgG 2800274..2856240 55966


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T295865 WP_000854686.1 NZ_OW967802:c2809272-2808889 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT295865 WP_001285602.1 NZ_OW967802:c2809733-2809353 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References