Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1345320..1345945 | Replicon | chromosome |
Accession | NZ_OW967802 | ||
Organism | Escherichia coli isolate 410 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LQ147_RS06545 | Protein ID | WP_000911330.1 |
Coordinates | 1345547..1345945 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | LQ147_RS06540 | Protein ID | WP_000450524.1 |
Coordinates | 1345320..1345547 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ147_RS06515 (1341123) | 1341123..1341593 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
LQ147_RS06520 (1341593) | 1341593..1342165 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
LQ147_RS06525 (1342311) | 1342311..1343189 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
LQ147_RS06530 (1343206) | 1343206..1344240 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
LQ147_RS06535 (1344453) | 1344453..1345166 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
LQ147_RS06540 (1345320) | 1345320..1345547 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
LQ147_RS06545 (1345547) | 1345547..1345945 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ147_RS06550 (1346092) | 1346092..1346955 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
LQ147_RS06555 (1346970) | 1346970..1348985 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
LQ147_RS06560 (1349059) | 1349059..1349400 | + | 342 | Protein_1286 | esterase | - |
LQ147_RS06565 (1349482) | 1349482..1350228 | - | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T295858 WP_000911330.1 NZ_OW967802:1345547-1345945 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|