Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1045156..1045739 | Replicon | chromosome |
Accession | NZ_OW967802 | ||
Organism | Escherichia coli isolate 410 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | LQ147_RS05085 | Protein ID | WP_000254738.1 |
Coordinates | 1045404..1045739 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | LQ147_RS05080 | Protein ID | WP_000581937.1 |
Coordinates | 1045156..1045404 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ147_RS05070 (1041495) | 1041495..1042796 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
LQ147_RS05075 (1042844) | 1042844..1045078 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
LQ147_RS05080 (1045156) | 1045156..1045404 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LQ147_RS05085 (1045404) | 1045404..1045739 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
LQ147_RS05090 (1045810) | 1045810..1046601 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
LQ147_RS05095 (1046829) | 1046829..1048466 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
LQ147_RS05100 (1048554) | 1048554..1049852 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T295856 WP_000254738.1 NZ_OW967802:1045404-1045739 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|