Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 93936..94561 | Replicon | plasmid P1 |
| Accession | NZ_OW967796 | ||
| Organism | Escherichia coli isolate 538 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LQ148_RS23275 | Protein ID | WP_000911317.1 |
| Coordinates | 94163..94561 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | LQ148_RS23270 | Protein ID | WP_000450532.1 |
| Coordinates | 93936..94163 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ148_RS23270 (93936) | 93936..94163 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| LQ148_RS23275 (94163) | 94163..94561 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ148_RS23280 (94570) | 94570..96723 | - | 2154 | WP_001523486.1 | type IV conjugative transfer system coupling protein TraD | - |
| LQ148_RS23285 (96976) | 96976..97707 | - | 732 | WP_001523488.1 | conjugal transfer complement resistance protein TraT | - |
| LQ148_RS23290 (97756) | 97756..98241 | - | 486 | WP_230158930.1 | surface exclusion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | papH / papC / hlyB / iroB / iroC / iroD / iroE / iroN / papC / papH | 1..148717 | 148717 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T295846 WP_000911317.1 NZ_OW967796:94163-94561 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|