Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 82356..82891 Replicon plasmid P1
Accession NZ_OW967796
Organism Escherichia coli isolate 538

Toxin (Protein)


Gene name relE Uniprot ID T1PX77
Locus tag LQ148_RS23210 Protein ID WP_001523468.1
Coordinates 82356..82643 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T1PXV2
Locus tag LQ148_RS23215 Protein ID WP_001139206.1
Coordinates 82640..82891 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ148_RS23190 (77807) 77807..78571 - 765 WP_001523453.1 helix-turn-helix domain-containing protein -
LQ148_RS23195 (79574) 79574..80167 + 594 WP_001523457.1 ProQ/FINO family protein -
LQ148_RS23200 (80447) 80447..81034 - 588 WP_024189343.1 serine acetyltransferase -
LQ148_RS23205 (81801) 81801..82346 - 546 WP_001523466.1 hypothetical protein -
LQ148_RS23210 (82356) 82356..82643 - 288 WP_001523468.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LQ148_RS23215 (82640) 82640..82891 - 252 WP_001139206.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQ148_RS23220 (82978) 82978..83145 - 168 WP_032146603.1 hypothetical protein -
LQ148_RS23225 (83847) 83847..84704 - 858 WP_001523472.1 incFII family plasmid replication initiator RepA -
LQ148_RS23230 (84697) 84697..85179 - 483 WP_001523473.1 hypothetical protein -
LQ148_RS23235 (85172) 85172..85246 - 75 WP_001442103.1 RepA leader peptide Tap -
LQ148_RS23240 (85480) 85480..85737 - 258 WP_000083845.1 replication regulatory protein RepA -
LQ148_RS23245 (86021) 86021..86170 - 150 WP_001312851.1 Hok/Gef family protein -
- (86214) 86214..86275 + 62 NuclAT_1 - -
- (86214) 86214..86275 + 62 NuclAT_1 - -
- (86214) 86214..86275 + 62 NuclAT_1 - -
- (86214) 86214..86275 + 62 NuclAT_1 - -
LQ148_RS23250 (86858) 86858..87070 - 213 WP_032084501.1 hypothetical protein -
LQ148_RS23255 (87203) 87203..87763 - 561 WP_001523482.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - papH / papC / hlyB / iroB / iroC / iroD / iroE / iroN / papC / papH 1..148717 148717


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11142.18 Da        Isoelectric Point: 10.6741

>T295844 WP_001523468.1 NZ_OW967796:c82643-82356 [Escherichia coli]
MTYTVKFRDDALREWLRLDKAIQQQFAKKLKKCSENPHIASAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSHVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9171.39 Da        Isoelectric Point: 4.0927

>AT295844 WP_001139206.1 NZ_OW967796:c82891-82640 [Escherichia coli]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSSQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T1PX77

Antitoxin

Source ID Structure
AlphaFold DB T1PXV2

References