Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3813596..3814146 Replicon chromosome
Accession NZ_OW967795
Organism Escherichia coli isolate 538

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag LQ148_RS18440 Protein ID WP_001160966.1
Coordinates 3813596..3813910 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag LQ148_RS18445 Protein ID WP_000125566.1
Coordinates 3813913..3814146 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ148_RS18415 (3809271) 3809271..3810557 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
LQ148_RS18420 (3810557) 3810557..3811546 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
LQ148_RS18425 (3811543) 3811543..3812364 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
LQ148_RS18430 (3812367) 3812367..3812744 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
LQ148_RS18435 (3812751) 3812751..3813599 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
LQ148_RS18440 (3813596) 3813596..3813910 - 315 WP_001160966.1 CcdB family protein Toxin
LQ148_RS18445 (3813913) 3813913..3814146 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LQ148_RS18450 (3814232) 3814232..3814711 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
LQ148_RS18455 (3814903) 3814903..3816765 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
LQ148_RS18460 (3816758) 3816758..3817288 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
LQ148_RS18465 (3817396) 3817396..3818727 - 1332 WP_022296925.1 MFS transporter -
LQ148_RS18470 (3818786) 3818786..3819073 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T295840 WP_001160966.1 NZ_OW967795:c3813910-3813596 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT295840 WP_000125566.1 NZ_OW967795:c3814146-3813913 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References