Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3340877..3341495 | Replicon | chromosome |
Accession | NZ_OW967795 | ||
Organism | Escherichia coli isolate 538 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LQ148_RS16145 | Protein ID | WP_001291435.1 |
Coordinates | 3341277..3341495 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LQ148_RS16140 | Protein ID | WP_000344800.1 |
Coordinates | 3340877..3341251 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ148_RS16130 (3335967) | 3335967..3337160 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ148_RS16135 (3337183) | 3337183..3340332 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
LQ148_RS16140 (3340877) | 3340877..3341251 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LQ148_RS16145 (3341277) | 3341277..3341495 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LQ148_RS16150 (3341668) | 3341668..3342219 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
LQ148_RS16155 (3342335) | 3342335..3342805 | + | 471 | WP_000136192.1 | YlaC family protein | - |
LQ148_RS16160 (3342969) | 3342969..3344519 | + | 1551 | WP_022296625.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LQ148_RS16165 (3344561) | 3344561..3344914 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
LQ148_RS16175 (3345293) | 3345293..3345604 | + | 312 | WP_000409908.1 | MGMT family protein | - |
LQ148_RS16180 (3345635) | 3345635..3346207 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295838 WP_001291435.1 NZ_OW967795:3341277-3341495 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT295838 WP_000344800.1 NZ_OW967795:3340877-3341251 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |