Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1823095..1823926 Replicon chromosome
Accession NZ_OW967795
Organism Escherichia coli isolate 538

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag LQ148_RS08570 Protein ID WP_000854815.1
Coordinates 1823095..1823469 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag LQ148_RS08575 Protein ID WP_001280918.1
Coordinates 1823558..1823926 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ148_RS08530 (1818491) 1818491..1819657 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
LQ148_RS08535 (1819776) 1819776..1820249 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
LQ148_RS08540 (1820447) 1820447..1821505 + 1059 WP_021576020.1 FUSC family protein -
LQ148_RS08545 (1821677) 1821677..1822006 + 330 WP_000450409.1 DUF496 family protein -
LQ148_RS08550 (1822107) 1822107..1822241 - 135 WP_059338447.1 EutP/PduV family microcompartment system protein -
LQ148_RS08555 (1822343) 1822343..1822489 + 147 Protein_1676 transposase domain-containing protein -
LQ148_RS08560 (1822778) 1822778..1822858 - 81 Protein_1677 hypothetical protein -
LQ148_RS08565 (1822904) 1822904..1823098 - 195 WP_000988600.1 DUF5983 family protein -
LQ148_RS08570 (1823095) 1823095..1823469 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LQ148_RS08575 (1823558) 1823558..1823926 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ148_RS08580 (1823942) 1823942..1824586 - 645 WP_000086752.1 hypothetical protein -
LQ148_RS08585 (1824605) 1824605..1824826 - 222 WP_000692345.1 DUF987 domain-containing protein -
LQ148_RS08590 (1824889) 1824889..1825365 - 477 WP_001186200.1 RadC family protein -
LQ148_RS08595 (1825381) 1825381..1825854 - 474 WP_001542276.1 antirestriction protein -
LQ148_RS08600 (1825948) 1825948..1826193 - 246 WP_001164966.1 hypothetical protein -
LQ148_RS08605 (1826193) 1826193..1827011 - 819 WP_001542275.1 DUF932 domain-containing protein -
LQ148_RS08610 (1827232) 1827232..1827642 - 411 WP_022296236.1 hypothetical protein -
LQ148_RS08615 (1827658) 1827658..1828335 - 678 WP_001362823.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T295830 WP_000854815.1 NZ_OW967795:c1823469-1823095 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT295830 WP_001280918.1 NZ_OW967795:c1823926-1823558 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References