Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1040552..1041135 | Replicon | chromosome |
Accession | NZ_OW967795 | ||
Organism | Escherichia coli isolate 538 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | LQ148_RS04955 | Protein ID | WP_022296743.1 |
Coordinates | 1040800..1041135 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | LQ148_RS04950 | Protein ID | WP_022296742.1 |
Coordinates | 1040552..1040800 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ148_RS04940 (1036891) | 1036891..1038192 | + | 1302 | WP_000046819.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
LQ148_RS04945 (1038240) | 1038240..1040474 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
LQ148_RS04950 (1040552) | 1040552..1040800 | + | 249 | WP_022296742.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LQ148_RS04955 (1040800) | 1040800..1041135 | + | 336 | WP_022296743.1 | endoribonuclease MazF | Toxin |
LQ148_RS04960 (1041207) | 1041207..1041998 | + | 792 | WP_001071631.1 | nucleoside triphosphate pyrophosphohydrolase | - |
LQ148_RS04965 (1042226) | 1042226..1043863 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
LQ148_RS04970 (1043951) | 1043951..1045249 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12127.99 Da Isoelectric Point: 8.4777
>T295828 WP_022296743.1 NZ_OW967795:1040800-1041135 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLYVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLYVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|