Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 884024..884678 | Replicon | chromosome |
| Accession | NZ_OW967795 | ||
| Organism | Escherichia coli isolate 538 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | LQ148_RS04325 | Protein ID | WP_000244765.1 |
| Coordinates | 884271..884678 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | LQ148_RS04320 | Protein ID | WP_000354046.1 |
| Coordinates | 884024..884290 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ148_RS04300 (880112) | 880112..881545 | - | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
| LQ148_RS04305 (881590) | 881590..881901 | + | 312 | WP_001525592.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ148_RS04310 (882065) | 882065..882724 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
| LQ148_RS04315 (882801) | 882801..883781 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
| LQ148_RS04320 (884024) | 884024..884290 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| LQ148_RS04325 (884271) | 884271..884678 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
| LQ148_RS04330 (884718) | 884718..885239 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| LQ148_RS04335 (885351) | 885351..886247 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| LQ148_RS04340 (886272) | 886272..886982 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ148_RS04345 (886988) | 886988..888721 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T295827 WP_000244765.1 NZ_OW967795:884271-884678 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |