Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 290682..291482 | Replicon | chromosome |
Accession | NZ_OW967795 | ||
Organism | Escherichia coli isolate 538 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | LQ148_RS01350 | Protein ID | WP_021555761.1 |
Coordinates | 290955..291482 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | LQ148_RS01345 | Protein ID | WP_001277107.1 |
Coordinates | 290682..290948 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ148_RS01320 (285992) | 285992..286846 | - | 855 | WP_000368745.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
LQ148_RS01325 (286839) | 286839..287585 | - | 747 | WP_000021882.1 | PTS sugar transporter subunit IIC | - |
LQ148_RS01330 (287602) | 287602..288087 | - | 486 | WP_000029256.1 | PTS sugar transporter subunit IIB | - |
LQ148_RS01335 (288094) | 288094..288495 | - | 402 | WP_001071333.1 | PTS sugar transporter subunit IIA | - |
LQ148_RS01340 (289430) | 289430..290533 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
LQ148_RS01345 (290682) | 290682..290948 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
LQ148_RS01350 (290955) | 290955..291482 | + | 528 | WP_021555761.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
LQ148_RS01355 (291479) | 291479..291862 | - | 384 | WP_001525853.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
LQ148_RS01360 (292286) | 292286..293395 | + | 1110 | WP_001297972.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
LQ148_RS01365 (293443) | 293443..294369 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
LQ148_RS01370 (294366) | 294366..295643 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
LQ148_RS01375 (295640) | 295640..296407 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19664.56 Da Isoelectric Point: 6.4791
>T295825 WP_021555761.1 NZ_OW967795:290955-291482 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTQLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTQLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|