Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 67238..67974 | Replicon | 2 plasmid P1 |
Accession | NZ_OW967519 | ||
Organism | Klebsiella oxytoca isolate |
Toxin (Protein)
Gene name | tacT | Uniprot ID | J5UJ49 |
Locus tag | LQ214_RS28950 | Protein ID | WP_009654334.1 |
Coordinates | 67492..67974 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | LQ214_RS28945 | Protein ID | WP_003026799.1 |
Coordinates | 67238..67504 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ214_RS28925 (AI2744V1_5651) | 63238..64206 | - | 969 | WP_077266818.1 | IS5 family transposase | - |
LQ214_RS28930 (AI2744V1_5652) | 64186..65217 | + | 1032 | WP_064352057.1 | IS110 family transposase | - |
LQ214_RS28935 (AI2744V1_5653) | 65536..66504 | - | 969 | WP_077267151.1 | IS5 family transposase | - |
LQ214_RS28940 (AI2744V1_5654) | 66565..66999 | + | 435 | WP_042928448.1 | cell envelope integrity protein TolA | - |
LQ214_RS28945 (AI2744V1_5655) | 67238..67504 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
LQ214_RS28950 (AI2744V1_5656) | 67492..67974 | + | 483 | WP_009654334.1 | GNAT family N-acetyltransferase | Toxin |
LQ214_RS28955 (AI2744V1_5657) | 68181..69527 | + | 1347 | WP_077266289.1 | ISNCY family transposase | - |
LQ214_RS28960 (AI2744V1_5658) | 69576..69974 | + | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
LQ214_RS28965 (AI2744V1_REPA000000036) | 70338..70472 | - | 135 | Protein_67 | IS5/IS1182 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..195319 | 195319 | |
- | inside | IScluster/Tn | - | - | 63238..79449 | 16211 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17339.06 Da Isoelectric Point: 8.7400
>T295822 WP_009654334.1 NZ_OW967519:67492-67974 [Klebsiella oxytoca]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHVKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYVHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHVKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYVHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4QCA1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |