Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 67238..67974 | Replicon | 2 plasmid P1 |
| Accession | NZ_OW967519 | ||
| Organism | Klebsiella oxytoca isolate | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | J5UJ49 |
| Locus tag | LQ214_RS28950 | Protein ID | WP_009654334.1 |
| Coordinates | 67492..67974 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | LQ214_RS28945 | Protein ID | WP_003026799.1 |
| Coordinates | 67238..67504 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ214_RS28925 (AI2744V1_5651) | 63238..64206 | - | 969 | WP_077266818.1 | IS5 family transposase | - |
| LQ214_RS28930 (AI2744V1_5652) | 64186..65217 | + | 1032 | WP_064352057.1 | IS110 family transposase | - |
| LQ214_RS28935 (AI2744V1_5653) | 65536..66504 | - | 969 | WP_077267151.1 | IS5 family transposase | - |
| LQ214_RS28940 (AI2744V1_5654) | 66565..66999 | + | 435 | WP_042928448.1 | cell envelope integrity protein TolA | - |
| LQ214_RS28945 (AI2744V1_5655) | 67238..67504 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ214_RS28950 (AI2744V1_5656) | 67492..67974 | + | 483 | WP_009654334.1 | GNAT family N-acetyltransferase | Toxin |
| LQ214_RS28955 (AI2744V1_5657) | 68181..69527 | + | 1347 | WP_077266289.1 | ISNCY family transposase | - |
| LQ214_RS28960 (AI2744V1_5658) | 69576..69974 | + | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
| LQ214_RS28965 (AI2744V1_REPA000000036) | 70338..70472 | - | 135 | Protein_67 | IS5/IS1182 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..195319 | 195319 | |
| - | inside | IScluster/Tn | - | - | 63238..79449 | 16211 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17339.06 Da Isoelectric Point: 8.7400
>T295822 WP_009654334.1 NZ_OW967519:67492-67974 [Klebsiella oxytoca]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHVKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYVHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDISLHVKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYVHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4QCA1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |