Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11120..11763 | Replicon | 2 plasmid P1 |
| Accession | NZ_OW967519 | ||
| Organism | Klebsiella oxytoca isolate | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | LQ214_RS28685 | Protein ID | WP_016236302.1 |
| Coordinates | 11347..11763 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | LQ214_RS28680 | Protein ID | WP_001261282.1 |
| Coordinates | 11120..11350 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ214_RS28655 (AI2744V1_5600) | 6836..7093 | - | 258 | WP_023292103.1 | hypothetical protein | - |
| LQ214_RS28660 | 7572..8300 | + | 729 | Protein_6 | CSS-motif domain-containing protein | - |
| LQ214_RS28665 | 8316..9152 | + | 837 | WP_032693954.1 | EAL domain-containing protein | - |
| LQ214_RS28670 (AI2744V1_5602) | 9770..10201 | - | 432 | WP_174805835.1 | hypothetical protein | - |
| LQ214_RS28675 | 10741..11163 | - | 423 | WP_160887026.1 | hypothetical protein | - |
| LQ214_RS28680 (AI2744V1_5603) | 11120..11350 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ214_RS28685 (AI2744V1_5604) | 11347..11763 | + | 417 | WP_016236302.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ214_RS28690 (AI2744V1_5605) | 11837..13399 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| LQ214_RS28695 (AI2744V1_5606) | 13384..14406 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| LQ214_RS28700 (AI2744V1_5607) | 14951..15859 | + | 909 | WP_032451458.1 | HNH endonuclease | - |
| LQ214_RS28705 (AI2744V1_5609) | 16045..16395 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..195319 | 195319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15091.55 Da Isoelectric Point: 7.1084
>T295821 WP_016236302.1 NZ_OW967519:11347-11763 [Klebsiella oxytoca]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|