Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4808168..4808987 | Replicon | chromosome |
Accession | NZ_OW967518 | ||
Organism | Klebsiella oxytoca isolate |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | LQ214_RS22990 | Protein ID | WP_004110819.1 |
Coordinates | 4808730..4808987 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | LQ214_RS22985 | Protein ID | WP_023320373.1 |
Coordinates | 4808168..4808719 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ214_RS22955 (AI2744V1_4507) | 4803547..4804227 | + | 681 | WP_023320375.1 | nitroreductase | - |
LQ214_RS22960 (AI2744V1_4508) | 4804235..4805437 | - | 1203 | WP_023320374.1 | multidrug effflux MFS transporter | - |
LQ214_RS22965 | 4805940..4806143 | - | 204 | Protein_4525 | VOC family protein | - |
LQ214_RS22970 (AI2744V1_4509) | 4806143..4806352 | - | 210 | WP_196089984.1 | hypothetical protein | - |
LQ214_RS22975 | 4806522..4807286 | - | 765 | WP_224226441.1 | class I SAM-dependent methyltransferase | - |
LQ214_RS22980 | 4807680..4808054 | - | 375 | Protein_4528 | class I SAM-dependent methyltransferase | - |
LQ214_RS22985 (AI2744V1_4511) | 4808168..4808719 | - | 552 | WP_023320373.1 | N-acetyltransferase | Antitoxin |
LQ214_RS22990 (AI2744V1_4512) | 4808730..4808987 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
LQ214_RS22995 (AI2744V1_4513) | 4809569..4810753 | + | 1185 | WP_004099225.1 | mannonate dehydratase | - |
LQ214_RS23000 (AI2744V1_4514) | 4810828..4812303 | + | 1476 | WP_004110817.1 | fructuronate reductase | - |
LQ214_RS23005 (AI2744V1_4515) | 4812439..4813215 | + | 777 | WP_004099223.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T295820 WP_004110819.1 NZ_OW967518:c4808987-4808730 [Klebsiella oxytoca]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20138.98 Da Isoelectric Point: 6.8799
>AT295820 WP_023320373.1 NZ_OW967518:c4808719-4808168 [Klebsiella oxytoca]
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHAAYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHAAYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|