Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4544667..4545286 | Replicon | chromosome |
| Accession | NZ_OW967518 | ||
| Organism | Klebsiella oxytoca isolate | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | LQ214_RS21740 | Protein ID | WP_004099646.1 |
| Coordinates | 4545068..4545286 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LQ214_RS21735 | Protein ID | WP_004099648.1 |
| Coordinates | 4544667..4545041 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ214_RS21725 (AI2744V1_4261) | 4539823..4541016 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ214_RS21730 (AI2744V1_4262) | 4541039..4544185 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQ214_RS21735 (AI2744V1_4263) | 4544667..4545041 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ214_RS21740 (AI2744V1_4264) | 4545068..4545286 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| LQ214_RS21745 (AI2744V1_4265) | 4545447..4546013 | + | 567 | WP_023320460.1 | maltose O-acetyltransferase | - |
| LQ214_RS21750 | 4545982..4546119 | - | 138 | WP_224226357.1 | hypothetical protein | - |
| LQ214_RS21755 (AI2744V1_4266) | 4546150..4546620 | + | 471 | WP_004111038.1 | YlaC family protein | - |
| LQ214_RS21760 (AI2744V1_4267) | 4546595..4548049 | - | 1455 | WP_023320459.1 | PLP-dependent aminotransferase family protein | - |
| LQ214_RS21765 (AI2744V1_4268) | 4548151..4548849 | + | 699 | WP_004099639.1 | GNAT family protein | - |
| LQ214_RS21770 (AI2744V1_4269) | 4548846..4548986 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LQ214_RS21775 (AI2744V1_4270) | 4548986..4549249 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T295819 WP_004099646.1 NZ_OW967518:4545068-4545286 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT295819 WP_004099648.1 NZ_OW967518:4544667-4545041 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|