Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1352623..1353395 | Replicon | chromosome |
Accession | NZ_OW967518 | ||
Organism | Klebsiella oxytoca isolate |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | LQ214_RS06600 | Protein ID | WP_064351566.1 |
Coordinates | 1352623..1352997 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | LQ214_RS06605 | Protein ID | WP_049115328.1 |
Coordinates | 1353036..1353395 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ214_RS06575 (AI2744V1_1281) | 1348567..1349469 | - | 903 | WP_064351591.1 | bacteriophage abortive infection AbiH family protein | - |
LQ214_RS06580 (AI2744V1_1282) | 1349556..1349819 | + | 264 | WP_228306239.1 | hypothetical protein | - |
LQ214_RS06585 | 1350114..1350473 | + | 360 | WP_228306240.1 | hypothetical protein | - |
LQ214_RS06590 (AI2744V1_1283) | 1351095..1352084 | + | 990 | WP_064351567.1 | glycosyltransferase | - |
LQ214_RS06595 (AI2744V1_1284) | 1352088..1352543 | + | 456 | WP_225373941.1 | hypothetical protein | - |
LQ214_RS06600 (AI2744V1_1286) | 1352623..1352997 | - | 375 | WP_064351566.1 | TA system toxin CbtA family protein | Toxin |
LQ214_RS06605 (AI2744V1_1287) | 1353036..1353395 | - | 360 | WP_049115328.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ214_RS06610 (AI2744V1_1288) | 1353418..1353639 | - | 222 | WP_064351565.1 | DUF987 domain-containing protein | - |
LQ214_RS06615 (AI2744V1_1289) | 1353653..1354135 | - | 483 | WP_064351564.1 | DNA repair protein RadC | - |
LQ214_RS06620 (AI2744V1_1290) | 1354132..1354365 | - | 234 | WP_064351563.1 | hypothetical protein | - |
LQ214_RS06625 (AI2744V1_1291) | 1354376..1354771 | - | 396 | WP_162881977.1 | antirestriction protein | - |
LQ214_RS06630 (AI2744V1_1292) | 1354934..1355755 | - | 822 | WP_064351561.1 | DUF932 domain-containing protein | - |
LQ214_RS06635 (AI2744V1_1293) | 1355862..1356074 | - | 213 | WP_032755286.1 | hypothetical protein | - |
LQ214_RS06640 (AI2744V1_1294) | 1356160..1356519 | - | 360 | WP_004136901.1 | hypothetical protein | - |
LQ214_RS06645 (AI2744V1_1295) | 1356574..1357038 | - | 465 | WP_004136903.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1342087..1370180 | 28093 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13859.91 Da Isoelectric Point: 10.0015
>T295814 WP_064351566.1 NZ_OW967518:c1352997-1352623 [Klebsiella oxytoca]
MQIQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDMLRARKATGLMTRKGYKTVTDITGGRFSGGK
MQIQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDMLRARKATGLMTRKGYKTVTDITGGRFSGGK
Download Length: 375 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13365.43 Da Isoelectric Point: 7.3727
>AT295814 WP_049115328.1 NZ_OW967518:c1353395-1353036 [Klebsiella oxytoca]
MQKATRVINHNITEPWWGLRRNITPCFGARLVQEGNHLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLTSNELT
PHIQRCITIHAKGLICEADTLGSCGYLYIVIYPASATTA
MQKATRVINHNITEPWWGLRRNITPCFGARLVQEGNHLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLTSNELT
PHIQRCITIHAKGLICEADTLGSCGYLYIVIYPASATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|