Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 901618..902275 | Replicon | chromosome |
Accession | NZ_OW967518 | ||
Organism | Klebsiella oxytoca isolate |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A181X6I0 |
Locus tag | LQ214_RS04420 | Protein ID | WP_004105559.1 |
Coordinates | 901865..902275 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A285B945 |
Locus tag | LQ214_RS04415 | Protein ID | WP_004105561.1 |
Coordinates | 901618..901884 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ214_RS04400 (AI2744V1_0856) | 896871..897296 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
LQ214_RS04405 (AI2744V1_0857) | 897417..900215 | - | 2799 | WP_023321613.1 | transcriptional regulator DagR | - |
LQ214_RS04410 (AI2744V1_0858) | 900391..901374 | - | 984 | WP_004115279.1 | tRNA-modifying protein YgfZ | - |
LQ214_RS04415 (AI2744V1_0860) | 901618..901884 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
LQ214_RS04420 (AI2744V1_0861) | 901865..902275 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
LQ214_RS04425 (AI2744V1_0862) | 902284..902805 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
LQ214_RS04430 (AI2744V1_0863) | 902927..903823 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
LQ214_RS04435 (AI2744V1_0864) | 903846..904559 | + | 714 | WP_023321612.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ214_RS04440 (AI2744V1_0865) | 904565..906298 | + | 1734 | WP_004105553.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T295813 WP_004105559.1 NZ_OW967518:901865-902275 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A181X6I0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285B945 |