Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3861217..3861874 | Replicon | chromosome |
Accession | NZ_OW967388 | ||
Organism | Enterobacter cloacae isolate 114 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0A6GSQ9 |
Locus tag | LQ218_RS18580 | Protein ID | WP_022649305.1 |
Coordinates | 3861217..3861627 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | LQ218_RS18585 | Protein ID | WP_003863437.1 |
Coordinates | 3861608..3861874 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ218_RS18560 (AI2624V1_3608) | 3857215..3858948 | - | 1734 | WP_022651808.1 | single-stranded-DNA-specific exonuclease RecJ | - |
LQ218_RS18565 (AI2624V1_3609) | 3858954..3859667 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ218_RS18570 (AI2624V1_3610) | 3859696..3860592 | - | 897 | WP_022651809.1 | site-specific tyrosine recombinase XerD | - |
LQ218_RS18575 (AI2624V1_3611) | 3860694..3861215 | + | 522 | WP_003863440.1 | flavodoxin FldB | - |
LQ218_RS18580 (AI2624V1_3612) | 3861217..3861627 | - | 411 | WP_022649305.1 | protein YgfX | Toxin |
LQ218_RS18585 (AI2624V1_3613) | 3861608..3861874 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
LQ218_RS18590 (AI2624V1_3614) | 3862169..3863149 | + | 981 | WP_003863435.1 | tRNA-modifying protein YgfZ | - |
LQ218_RS18595 (AI2624V1_3616) | 3863235..3863894 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
LQ218_RS18600 (AI2624V1_3617) | 3864161..3864892 | + | 732 | WP_003863431.1 | MurR/RpiR family transcriptional regulator | - |
LQ218_RS18605 (AI2624V1_3618) | 3865009..3866442 | + | 1434 | WP_022651811.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T295811 WP_022649305.1 NZ_OW967388:c3861627-3861217 [Enterobacter cloacae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6GSQ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |