Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2305846..2306585 | Replicon | chromosome |
Accession | NZ_OW967388 | ||
Organism | Enterobacter cloacae isolate 114 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | LQ218_RS11135 | Protein ID | WP_003857133.1 |
Coordinates | 2305846..2306331 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | LQ218_RS11140 | Protein ID | WP_003857131.1 |
Coordinates | 2306319..2306585 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ218_RS11120 (AI2624V1_2163) | 2302713..2304146 | - | 1434 | WP_004016055.1 | restriction endonuclease | - |
LQ218_RS11125 (AI2624V1_2164) | 2304167..2304970 | - | 804 | WP_039268887.1 | TIGR02391 family protein | - |
LQ218_RS11130 (AI2624V1_2165) | 2304992..2305471 | - | 480 | WP_001542736.1 | hypothetical protein | - |
LQ218_RS11135 (AI2624V1_2166) | 2305846..2306331 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
LQ218_RS11140 (AI2624V1_2167) | 2306319..2306585 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
LQ218_RS11145 (AI2624V1_2168) | 2306649..2307578 | - | 930 | WP_022651200.1 | LysR family transcriptional regulator | - |
LQ218_RS11150 (AI2624V1_2169) | 2307708..2309096 | + | 1389 | WP_032645625.1 | MFS transporter | - |
LQ218_RS11155 (AI2624V1_2170) | 2309118..2310113 | - | 996 | WP_003857125.1 | DUF2891 domain-containing protein | - |
LQ218_RS11160 (AI2624V1_2171) | 2310123..2311109 | - | 987 | WP_022651202.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2284376..2306585 | 22209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T295805 WP_003857133.1 NZ_OW967388:c2306331-2305846 [Enterobacter cloacae]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L9PBP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |