Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1805044..1805655 Replicon chromosome
Accession NZ_OW967388
Organism Enterobacter cloacae isolate 114

Toxin (Protein)


Gene name hicA Uniprot ID D2TUP9
Locus tag LQ218_RS08630 Protein ID WP_012906750.1
Coordinates 1805476..1805655 (-) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A6G3F240
Locus tag LQ218_RS08625 Protein ID WP_045339414.1
Coordinates 1805044..1805454 (-) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ218_RS08605 (AI2624V1_1671) 1800853..1801404 + 552 WP_045345258.1 phage tail protein I -
LQ218_RS08610 (AI2624V1_1672) 1801407..1803968 + 2562 WP_058647401.1 phage tail protein -
LQ218_RS08615 (AI2624V1_1673) 1803970..1804392 + 423 WP_058647400.1 tail fiber assembly protein -
LQ218_RS08620 (AI2624V1_1674) 1804396..1804962 - 567 WP_058647399.1 serine acetyltransferase -
LQ218_RS08625 (AI2624V1_1675) 1805044..1805454 - 411 WP_045339414.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LQ218_RS08630 (AI2624V1_1676) 1805476..1805655 - 180 WP_012906750.1 type II toxin-antitoxin system HicA family toxin Toxin
LQ218_RS08635 (AI2624V1_1677) 1805923..1806093 + 171 Protein_1674 isocitrate/isopropylmalate family dehydrogenase -
LQ218_RS08640 (AI2624V1_1678) 1806169..1806414 + 246 WP_022650806.1 YmjA family protein -
LQ218_RS08645 (AI2624V1_1679) 1806419..1807918 - 1500 WP_022650807.1 EAL domain-containing protein -
LQ218_RS08650 1808043..1808135 - 93 WP_071524166.1 stress response membrane protein YncL -
LQ218_RS08655 (AI2624V1_1680) 1808507..1808755 + 249 WP_003857896.1 GlsB/YeaQ/YmgE family stress response membrane protein -
LQ218_RS08660 (AI2624V1_1681) 1808884..1808982 - 99 WP_015570793.1 YoaK family small membrane protein -
LQ218_RS08665 (AI2624V1_1682) 1809028..1809981 - 954 Protein_1680 sensor domain-containing diguanylate cyclase -
LQ218_RS08670 (AI2624V1_1683) 1810078..1810332 + 255 WP_022650809.1 DUF333 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6644.85 Da        Isoelectric Point: 10.9132

>T295804 WP_012906750.1 NZ_OW967388:c1805655-1805476 [Enterobacter cloacae]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14890.79 Da        Isoelectric Point: 4.3170

>AT295804 WP_045339414.1 NZ_OW967388:c1805454-1805044 [Enterobacter cloacae]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDDYQDAIESVREAIEAHIELLVEDGESVPEATTVENWLSDPEYAGAVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6XDK4

Antitoxin

Source ID Structure
AlphaFold DB A0A6G3F240

References