Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1081820..1082440 | Replicon | chromosome |
Accession | NZ_OW967388 | ||
Organism | Enterobacter cloacae isolate 114 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | LQ218_RS05135 | Protein ID | WP_015571250.1 |
Coordinates | 1081820..1082038 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | LQ218_RS05140 | Protein ID | WP_006809850.1 |
Coordinates | 1082066..1082440 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ218_RS05105 (AI2624V1_0989) | 1077832..1078092 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
LQ218_RS05110 (AI2624V1_0990) | 1078095..1078235 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
LQ218_RS05115 (AI2624V1_0991) | 1078232..1078942 | - | 711 | WP_022650493.1 | GNAT family protein | - |
LQ218_RS05120 (AI2624V1_0992) | 1079044..1080504 | + | 1461 | WP_022650494.1 | PLP-dependent aminotransferase family protein | - |
LQ218_RS05125 (AI2624V1_0993) | 1080476..1080943 | - | 468 | WP_022650495.1 | YlaC family protein | - |
LQ218_RS05130 (AI2624V1_0994) | 1081060..1081611 | - | 552 | WP_022650496.1 | maltose O-acetyltransferase | - |
LQ218_RS05135 (AI2624V1_0995) | 1081820..1082038 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
LQ218_RS05140 (AI2624V1_0996) | 1082066..1082440 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
LQ218_RS05145 (AI2624V1_0997) | 1082951..1086097 | - | 3147 | WP_022650497.1 | multidrug efflux RND transporter permease subunit AcrB | - |
LQ218_RS05150 (AI2624V1_0998) | 1086120..1087313 | - | 1194 | WP_058647476.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T295802 WP_015571250.1 NZ_OW967388:c1082038-1081820 [Enterobacter cloacae]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT295802 WP_006809850.1 NZ_OW967388:c1082440-1082066 [Enterobacter cloacae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |