Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 581392..582095 | Replicon | chromosome |
| Accession | NZ_OW967388 | ||
| Organism | Enterobacter cloacae isolate 114 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A8B5ZZ18 |
| Locus tag | LQ218_RS02790 | Protein ID | WP_039268718.1 |
| Coordinates | 581754..582095 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A8B5ZWQ9 |
| Locus tag | LQ218_RS02785 | Protein ID | WP_039268717.1 |
| Coordinates | 581392..581733 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ218_RS02750 (AI2624V1_0526) | 576545..577420 | + | 876 | WP_039268712.1 | GTPase family protein | - |
| LQ218_RS02755 (AI2624V1_0527) | 577664..578380 | + | 717 | WP_039268713.1 | WYL domain-containing protein | - |
| LQ218_RS02760 | 578416..578868 | + | 453 | WP_039269148.1 | hypothetical protein | - |
| LQ218_RS02765 (AI2624V1_0530) | 578940..579413 | + | 474 | WP_039268714.1 | hypothetical protein | - |
| LQ218_RS02770 (AI2624V1_0531) | 579534..580355 | + | 822 | WP_039268715.1 | DUF932 domain-containing protein | - |
| LQ218_RS02775 (AI2624V1_0532) | 580386..580826 | + | 441 | WP_039268716.1 | antirestriction protein | - |
| LQ218_RS02780 (AI2624V1_0533) | 580839..581381 | + | 543 | WP_045259572.1 | DNA repair protein RadC | - |
| LQ218_RS02785 (AI2624V1_0534) | 581392..581733 | + | 342 | WP_039268717.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ218_RS02790 (AI2624V1_0535) | 581754..582095 | + | 342 | WP_039268718.1 | TA system toxin CbtA family protein | Toxin |
| LQ218_RS02795 (AI2624V1_0536) | 582350..583357 | + | 1008 | WP_039268719.1 | restriction endonuclease | - |
| LQ218_RS02800 | 583537..584373 | - | 837 | Protein_537 | HNH endonuclease | - |
| LQ218_RS02805 (AI2624V1_0540) | 584673..585140 | + | 468 | WP_022650322.1 | SymE family type I addiction module toxin | - |
| LQ218_RS02810 (AI2624V1_0541) | 585198..585569 | - | 372 | WP_022650323.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | fosA | - | 536451..590040 | 53589 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12772.83 Da Isoelectric Point: 9.6548
>T295801 WP_039268718.1 NZ_OW967388:581754-582095 [Enterobacter cloacae]
MKTLPATTPQAAKLCLLPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPATTPQAAKLCLLPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B5ZZ18 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B5ZWQ9 |