Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 298080..298676 | Replicon | chromosome |
Accession | NZ_OW967388 | ||
Organism | Enterobacter cloacae isolate 114 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A5D9Q9B8 |
Locus tag | LQ218_RS01430 | Protein ID | WP_003860348.1 |
Coordinates | 298374..298676 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A837FG03 |
Locus tag | LQ218_RS01425 | Protein ID | WP_022650216.1 |
Coordinates | 298080..298367 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ218_RS01420 (AI2624V1_0269) | 296452..298083 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
LQ218_RS01425 (AI2624V1_0270) | 298080..298367 | - | 288 | WP_022650216.1 | putative addiction module antidote protein | Antitoxin |
LQ218_RS01430 (AI2624V1_0271) | 298374..298676 | - | 303 | WP_003860348.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ218_RS01435 (AI2624V1_0272) | 298874..299746 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
LQ218_RS01440 (AI2624V1_0273) | 299747..300019 | - | 273 | WP_003860346.1 | DUF3811 domain-containing protein | - |
LQ218_RS01445 (AI2624V1_0274) | 300070..301014 | - | 945 | WP_022650218.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
LQ218_RS01450 (AI2624V1_0275) | 301108..302457 | - | 1350 | WP_003860344.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11393.20 Da Isoelectric Point: 10.1042
>T295800 WP_003860348.1 NZ_OW967388:c298676-298374 [Enterobacter cloacae]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHLGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHLGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5D9Q9B8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FG03 |