Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 54874..55610 | Replicon | plasmid P1 |
| Accession | NZ_OW967375 | ||
| Organism | Klebsiella oxytoca isolate 145 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | LQ212_RS28635 | Protein ID | WP_003026803.1 |
| Coordinates | 55128..55610 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | LQ212_RS28630 | Protein ID | WP_003026799.1 |
| Coordinates | 54874..55140 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ212_RS28585 (AI2623V1_5577) | 50936..51298 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| LQ212_RS28590 (AI2623V1_5578) | 51348..51698 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| LQ212_RS28595 (AI2623V1_5579) | 52056..52325 | + | 270 | WP_004152102.1 | hypothetical protein | - |
| LQ212_RS28600 (AI2623V1_5580) | 52313..52888 | + | 576 | WP_004152103.1 | hypothetical protein | - |
| LQ212_RS28605 (AI2623V1_5581) | 52919..53413 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
| LQ212_RS28610 (AI2623V1_5582) | 53457..53825 | + | 369 | WP_004152105.1 | hypothetical protein | - |
| LQ212_RS28615 (AI2623V1_5583) | 53859..54062 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| LQ212_RS28620 (AI2623V1_5584) | 54111..54368 | + | 258 | WP_004152107.1 | hypothetical protein | - |
| LQ212_RS28625 (AI2623V1_5585) | 54444..54698 | + | 255 | WP_004152108.1 | hypothetical protein | - |
| LQ212_RS28630 (AI2623V1_5586) | 54874..55140 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ212_RS28635 (AI2623V1_5587) | 55128..55610 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| LQ212_RS28640 (AI2623V1_5588) | 55811..57214 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| LQ212_RS28645 (AI2623V1_5589) | 57243..57875 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| LQ212_RS28650 (AI2623V1_5590) | 58101..59447 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| LQ212_RS28655 (AI2623V1_5591) | 59496..59891 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa | - | 1..253358 | 253358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T295799 WP_003026803.1 NZ_OW967375:55128-55610 [Klebsiella oxytoca]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |