Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 5269128..5269820 | Replicon | chromosome |
| Accession | NZ_OW967374 | ||
| Organism | Klebsiella oxytoca isolate 145 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | LQ212_RS24945 | Protein ID | WP_102804018.1 |
| Coordinates | 5269128..5269478 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | LQ212_RS24950 | Protein ID | WP_142385465.1 |
| Coordinates | 5269503..5269820 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ212_RS24920 (AI2623V1_4876) | 5264987..5265784 | - | 798 | WP_123830111.1 | helix-turn-helix transcriptional regulator | - |
| LQ212_RS24925 (AI2623V1_4877) | 5265928..5266761 | - | 834 | WP_153675657.1 | DUF4942 domain-containing protein | - |
| LQ212_RS24930 (AI2623V1_4878) | 5266909..5267643 | - | 735 | WP_123830109.1 | retron system putative HNH endonuclease | - |
| LQ212_RS24935 | 5267640..5267789 | - | 150 | WP_153675655.1 | hypothetical protein | - |
| LQ212_RS24940 (AI2623V1_4879) | 5267792..5269034 | - | 1243 | Protein_4908 | AAA family ATPase | - |
| LQ212_RS24945 (AI2623V1_4880) | 5269128..5269478 | - | 351 | WP_102804018.1 | TA system toxin CbtA family protein | Toxin |
| LQ212_RS24950 (AI2623V1_4881) | 5269503..5269820 | - | 318 | WP_142385465.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ212_RS24955 (AI2623V1_4882) | 5269878..5270099 | - | 222 | WP_102804016.1 | DUF987 domain-containing protein | - |
| LQ212_RS24960 (AI2623V1_4883) | 5270113..5270592 | - | 480 | WP_047724681.1 | DNA repair protein RadC | - |
| LQ212_RS24965 (AI2623V1_4884) | 5270605..5271054 | - | 450 | WP_102804015.1 | antirestriction protein | - |
| LQ212_RS24970 (AI2623V1_4885) | 5271087..5271908 | - | 822 | WP_102804014.1 | DUF932 domain-containing protein | - |
| LQ212_RS24975 | 5272584..5273055 | + | 472 | Protein_4915 | transposase | - |
| LQ212_RS24980 (AI2623V1_4887) | 5272994..5273233 | + | 240 | Protein_4916 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ212_RS24985 (AI2623V1_4888) | 5273603..5274340 | + | 738 | WP_047935074.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 5272994..5273251 | 257 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13220.22 Da Isoelectric Point: 8.1282
>T295798 WP_102804018.1 NZ_OW967374:c5269478-5269128 [Klebsiella oxytoca]
MKTLPANQWVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGTTLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLTQCKKRKCNQPDG
MKTLPANQWVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGTTLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLTQCKKRKCNQPDG
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|