Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4527434..4528053 | Replicon | chromosome |
Accession | NZ_OW967374 | ||
Organism | Klebsiella oxytoca isolate 145 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | LQ212_RS21545 | Protein ID | WP_004099646.1 |
Coordinates | 4527835..4528053 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | LQ212_RS21540 | Protein ID | WP_004099648.1 |
Coordinates | 4527434..4527808 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ212_RS21530 (AI2623V1_4218) | 4522590..4523783 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ212_RS21535 (AI2623V1_4219) | 4523806..4526952 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
LQ212_RS21540 (AI2623V1_4220) | 4527434..4527808 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
LQ212_RS21545 (AI2623V1_4221) | 4527835..4528053 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
LQ212_RS21550 (AI2623V1_4222) | 4528214..4528780 | + | 567 | WP_064344889.1 | maltose O-acetyltransferase | - |
LQ212_RS21555 | 4528749..4528886 | - | 138 | WP_224226357.1 | hypothetical protein | - |
LQ212_RS21560 (AI2623V1_4223) | 4528917..4529387 | + | 471 | WP_004099643.1 | YlaC family protein | - |
LQ212_RS21565 (AI2623V1_4224) | 4529362..4530816 | - | 1455 | WP_064344888.1 | PLP-dependent aminotransferase family protein | - |
LQ212_RS21570 (AI2623V1_4225) | 4530919..4531617 | + | 699 | WP_004099639.1 | GNAT family protein | - |
LQ212_RS21575 (AI2623V1_4226) | 4531614..4531754 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
LQ212_RS21580 (AI2623V1_4227) | 4531754..4532017 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T295796 WP_004099646.1 NZ_OW967374:4527835-4528053 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT295796 WP_004099648.1 NZ_OW967374:4527434-4527808 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|