Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1308170..1308953 | Replicon | chromosome |
Accession | NZ_OW967374 | ||
Organism | Klebsiella oxytoca isolate 145 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | LQ212_RS06315 | Protein ID | WP_010434197.1 |
Coordinates | 1308170..1308544 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | LQ212_RS06320 | Protein ID | WP_024274583.1 |
Coordinates | 1308594..1308953 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ212_RS06290 (AI2623V1_1232) | 1303842..1304075 | - | 234 | WP_004132711.1 | hypothetical protein | - |
LQ212_RS06295 (AI2623V1_1233) | 1304485..1304757 | + | 273 | WP_016247220.1 | hypothetical protein | - |
LQ212_RS06300 (AI2623V1_1234) | 1304960..1305868 | + | 909 | WP_024274585.1 | kdo(2)-lipid IV(A) palmitoleoyltransferase | - |
LQ212_RS06305 (AI2623V1_1235) | 1306642..1307631 | + | 990 | WP_010434201.1 | glycosyltransferase | - |
LQ212_RS06310 (AI2623V1_1236) | 1307635..1308090 | + | 456 | WP_226859238.1 | hypothetical protein | - |
LQ212_RS06315 (AI2623V1_1238) | 1308170..1308544 | - | 375 | WP_010434197.1 | TA system toxin CbtA family protein | Toxin |
LQ212_RS06320 (AI2623V1_1239) | 1308594..1308953 | - | 360 | WP_024274583.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ212_RS06325 (AI2623V1_1240) | 1308976..1309197 | - | 222 | WP_024274582.1 | DUF987 domain-containing protein | - |
LQ212_RS06330 (AI2623V1_1241) | 1309211..1309693 | - | 483 | WP_024274581.1 | DNA repair protein RadC | - |
LQ212_RS06335 (AI2623V1_1242) | 1309690..1309923 | - | 234 | WP_010434188.1 | hypothetical protein | - |
LQ212_RS06340 (AI2623V1_1243) | 1309934..1310413 | - | 480 | WP_010434186.1 | antirestriction protein | - |
LQ212_RS06345 (AI2623V1_1244) | 1310492..1311313 | - | 822 | WP_010434183.1 | DUF932 domain-containing protein | - |
LQ212_RS06350 (AI2623V1_1245) | 1311424..1311636 | - | 213 | WP_010434180.1 | hypothetical protein | - |
LQ212_RS06355 (AI2623V1_1246) | 1311717..1312076 | - | 360 | WP_010434179.1 | hypothetical protein | - |
LQ212_RS06360 (AI2623V1_1247) | 1312131..1312595 | - | 465 | WP_024274580.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | algU | 1306642..1429944 | 123302 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13977.96 Da Isoelectric Point: 9.6955
>T295791 WP_010434197.1 NZ_OW967374:c1308544-1308170 [Klebsiella oxytoca]
MQIHSLFLQRAASSRLSSVEIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLYDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDILRARKATGLMTRKGYKTVTDITGGRFSGGK
MQIHSLFLQRAASSRLSSVEIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLYDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDILRARKATGLMTRKGYKTVTDITGGRFSGGK
Download Length: 375 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13469.67 Da Isoelectric Point: 7.7511
>AT295791 WP_024274583.1 NZ_OW967374:c1308953-1308594 [Klebsiella oxytoca]
MKKATRVINHNITEPWWGLRRNITPCFGARLVQEGNHLHYLADRASIAGTFNDADLRHLDQVFPVLMKQMELMLASSELT
PRIQRCITLHVKGLICEADTLGSCGYLYIVIYPASVTTE
MKKATRVINHNITEPWWGLRRNITPCFGARLVQEGNHLHYLADRASIAGTFNDADLRHLDQVFPVLMKQMELMLASSELT
PRIQRCITLHVKGLICEADTLGSCGYLYIVIYPASVTTE
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|