Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 873075..873732 | Replicon | chromosome |
| Accession | NZ_OW967374 | ||
| Organism | Klebsiella oxytoca isolate 145 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A181X6I0 |
| Locus tag | LQ212_RS04225 | Protein ID | WP_004105559.1 |
| Coordinates | 873322..873732 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A285B945 |
| Locus tag | LQ212_RS04220 | Protein ID | WP_004105561.1 |
| Coordinates | 873075..873341 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ212_RS04195 (AI2623V1_0824) | 868255..869688 | - | 1434 | WP_064343807.1 | 6-phospho-beta-glucosidase BglA | - |
| LQ212_RS04200 (AI2623V1_0825) | 869809..870537 | - | 729 | WP_064352017.1 | MurR/RpiR family transcriptional regulator | - |
| LQ212_RS04205 (AI2623V1_0826) | 870588..870899 | + | 312 | WP_004105571.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ212_RS04210 (AI2623V1_0827) | 871061..871720 | + | 660 | WP_064344096.1 | hemolysin III family protein | - |
| LQ212_RS04215 (AI2623V1_0828) | 871848..872831 | - | 984 | WP_004115279.1 | tRNA-modifying protein YgfZ | - |
| LQ212_RS04220 (AI2623V1_0830) | 873075..873341 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
| LQ212_RS04225 (AI2623V1_0831) | 873322..873732 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
| LQ212_RS04230 (AI2623V1_0832) | 873741..874262 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
| LQ212_RS04235 (AI2623V1_0833) | 874384..875280 | + | 897 | WP_064343806.1 | site-specific tyrosine recombinase XerD | - |
| LQ212_RS04240 (AI2623V1_0834) | 875303..876016 | + | 714 | WP_064343805.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ212_RS04245 (AI2623V1_0835) | 876022..877755 | + | 1734 | WP_004105553.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T295790 WP_004105559.1 NZ_OW967374:873322-873732 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A181X6I0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285B945 |