Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 57870..58513 | Replicon | plasmid P2 |
| Accession | NZ_OW967265 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A6C0NE46 |
| Locus tag | LQ176_RS25670 | Protein ID | WP_008322233.1 |
| Coordinates | 57870..58286 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQ176_RS25675 | Protein ID | WP_001261276.1 |
| Coordinates | 58283..58513 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ176_RS25660 (AI2826V1_4988) | 55067..56407 | + | 1341 | WP_230133462.1 | hypothetical protein | - |
| LQ176_RS25665 (AI2826V1_4989) | 56404..57324 | + | 921 | WP_008322235.1 | carbohydrate kinase | - |
| LQ176_RS25670 (AI2826V1_4990) | 57870..58286 | - | 417 | WP_008322233.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ176_RS25675 (AI2826V1_4991) | 58283..58513 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ176_RS25680 (AI2826V1_4992) | 58766..59788 | - | 1023 | WP_008322227.1 | helicase UvrD | - |
| LQ176_RS25685 (AI2826V1_4993) | 59874..60578 | + | 705 | WP_001067848.1 | IS6-like element IS26 family transposase | - |
| LQ176_RS25690 | 60632..60829 | - | 198 | Protein_57 | MerR family transcriptional regulator | - |
| LQ176_RS25695 (AI2826V1_4995) | 60904..61044 | + | 141 | Protein_58 | mercuric transporter MerT family protein | - |
| LQ176_RS25700 (AI2826V1_4996) | 61377..62381 | + | 1005 | WP_000427623.1 | IS110-like element IS4321 family transposase | - |
| LQ176_RS25705 (AI2826V1_4997) | 62659..62874 | + | 216 | Protein_60 | mercuric transporter MerT family protein | - |
| LQ176_RS25710 (AI2826V1_4998) | 62887..63162 | + | 276 | WP_003150552.1 | mercury resistance system periplasmic binding protein MerP | - |
| LQ176_RS25715 (AI2826V1_4999) | 63170..63382 | + | 213 | WP_003089113.1 | GDCCVxC domain-containing (seleno)protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr | - | 1..99059 | 99059 | |
| - | inside | IScluster/Tn | sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr | - | 30159..68172 | 38013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15054.58 Da Isoelectric Point: 9.2957
>T295788 WP_008322233.1 NZ_OW967265:c58286-57870 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE46 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |