Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 57870..58513 Replicon plasmid P2
Accession NZ_OW967265
Organism Citrobacter freundii isolate 22

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NE46
Locus tag LQ176_RS25670 Protein ID WP_008322233.1
Coordinates 57870..58286 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQ176_RS25675 Protein ID WP_001261276.1
Coordinates 58283..58513 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ176_RS25660 (AI2826V1_4988) 55067..56407 + 1341 WP_230133462.1 hypothetical protein -
LQ176_RS25665 (AI2826V1_4989) 56404..57324 + 921 WP_008322235.1 carbohydrate kinase -
LQ176_RS25670 (AI2826V1_4990) 57870..58286 - 417 WP_008322233.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ176_RS25675 (AI2826V1_4991) 58283..58513 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ176_RS25680 (AI2826V1_4992) 58766..59788 - 1023 WP_008322227.1 helicase UvrD -
LQ176_RS25685 (AI2826V1_4993) 59874..60578 + 705 WP_001067848.1 IS6-like element IS26 family transposase -
LQ176_RS25690 60632..60829 - 198 Protein_57 MerR family transcriptional regulator -
LQ176_RS25695 (AI2826V1_4995) 60904..61044 + 141 Protein_58 mercuric transporter MerT family protein -
LQ176_RS25700 (AI2826V1_4996) 61377..62381 + 1005 WP_000427623.1 IS110-like element IS4321 family transposase -
LQ176_RS25705 (AI2826V1_4997) 62659..62874 + 216 Protein_60 mercuric transporter MerT family protein -
LQ176_RS25710 (AI2826V1_4998) 62887..63162 + 276 WP_003150552.1 mercury resistance system periplasmic binding protein MerP -
LQ176_RS25715 (AI2826V1_4999) 63170..63382 + 213 WP_003089113.1 GDCCVxC domain-containing (seleno)protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr - 1..99059 99059
- inside IScluster/Tn sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr - 30159..68172 38013


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15054.58 Da        Isoelectric Point: 9.2957

>T295788 WP_008322233.1 NZ_OW967265:c58286-57870 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT295788 WP_001261276.1 NZ_OW967265:c58513-58283 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE46

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References