Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 59724..60367 Replicon plasmid P1
Accession NZ_OW967264
Organism Citrobacter freundii isolate 22

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NE46
Locus tag LQ176_RS25170 Protein ID WP_008322233.1
Coordinates 59951..60367 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQ176_RS25165 Protein ID WP_001261276.1
Coordinates 59724..59954 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ176_RS25125 (AI2826V1_4882) 54925..55296 - 372 WP_003100853.1 hypothetical protein -
LQ176_RS25130 (AI2826V1_4883) 55293..55793 - 501 WP_003100856.1 hypothetical protein -
LQ176_RS25135 (AI2826V1_4884) 55790..56116 - 327 WP_003100858.1 hypothetical protein -
LQ176_RS25140 (AI2826V1_4885) 56371..56727 - 357 WP_000215515.1 cupin domain-containing protein -
LQ176_RS25145 (AI2826V1_4886) 56717..57118 - 402 WP_230133461.1 DUF86 domain-containing protein -
LQ176_RS25150 (AI2826V1_4887) 57115..57405 - 291 WP_001247892.1 nucleotidyltransferase -
LQ176_RS25155 (AI2826V1_4888) 57659..58363 - 705 WP_001067848.1 IS6-like element IS26 family transposase -
LQ176_RS25160 (AI2826V1_4889) 58449..59471 + 1023 WP_008322227.1 helicase UvrD -
LQ176_RS25165 (AI2826V1_4890) 59724..59954 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ176_RS25170 (AI2826V1_4891) 59951..60367 + 417 WP_008322233.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ176_RS25175 (AI2826V1_4892) 60913..61833 - 921 WP_008322235.1 carbohydrate kinase -
LQ176_RS25180 (AI2826V1_4893) 61830..63170 - 1341 WP_230133462.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..112775 112775
- inside IScluster/Tn - - 45944..66972 21028


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15054.58 Da        Isoelectric Point: 9.2957

>T295787 WP_008322233.1 NZ_OW967264:59951-60367 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT295787 WP_001261276.1 NZ_OW967264:59724-59954 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE46

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References