Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 59724..60367 | Replicon | plasmid P1 |
| Accession | NZ_OW967264 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A6C0NE46 |
| Locus tag | LQ176_RS25170 | Protein ID | WP_008322233.1 |
| Coordinates | 59951..60367 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LQ176_RS25165 | Protein ID | WP_001261276.1 |
| Coordinates | 59724..59954 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ176_RS25125 (AI2826V1_4882) | 54925..55296 | - | 372 | WP_003100853.1 | hypothetical protein | - |
| LQ176_RS25130 (AI2826V1_4883) | 55293..55793 | - | 501 | WP_003100856.1 | hypothetical protein | - |
| LQ176_RS25135 (AI2826V1_4884) | 55790..56116 | - | 327 | WP_003100858.1 | hypothetical protein | - |
| LQ176_RS25140 (AI2826V1_4885) | 56371..56727 | - | 357 | WP_000215515.1 | cupin domain-containing protein | - |
| LQ176_RS25145 (AI2826V1_4886) | 56717..57118 | - | 402 | WP_230133461.1 | DUF86 domain-containing protein | - |
| LQ176_RS25150 (AI2826V1_4887) | 57115..57405 | - | 291 | WP_001247892.1 | nucleotidyltransferase | - |
| LQ176_RS25155 (AI2826V1_4888) | 57659..58363 | - | 705 | WP_001067848.1 | IS6-like element IS26 family transposase | - |
| LQ176_RS25160 (AI2826V1_4889) | 58449..59471 | + | 1023 | WP_008322227.1 | helicase UvrD | - |
| LQ176_RS25165 (AI2826V1_4890) | 59724..59954 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ176_RS25170 (AI2826V1_4891) | 59951..60367 | + | 417 | WP_008322233.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ176_RS25175 (AI2826V1_4892) | 60913..61833 | - | 921 | WP_008322235.1 | carbohydrate kinase | - |
| LQ176_RS25180 (AI2826V1_4893) | 61830..63170 | - | 1341 | WP_230133462.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..112775 | 112775 | |
| - | inside | IScluster/Tn | - | - | 45944..66972 | 21028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15054.58 Da Isoelectric Point: 9.2957
>T295787 WP_008322233.1 NZ_OW967264:59951-60367 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE46 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |