Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 43586..44111 | Replicon | plasmid P1 |
| Accession | NZ_OW967264 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | W8EAA6 |
| Locus tag | LQ176_RS25055 | Protein ID | WP_008322213.1 |
| Coordinates | 43586..43891 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A6C0NE25 |
| Locus tag | LQ176_RS25060 | Protein ID | WP_032934863.1 |
| Coordinates | 43893..44111 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ176_RS25030 (AI2826V1_4861) | 39418..40056 | + | 639 | WP_008322203.1 | aldolase | - |
| LQ176_RS25035 (AI2826V1_4862) | 40061..40837 | + | 777 | WP_008322204.1 | HPr family phosphocarrier protein | - |
| LQ176_RS25040 (AI2826V1_4863) | 40923..42290 | + | 1368 | WP_008322207.1 | GntP family transporter | - |
| LQ176_RS25045 (AI2826V1_4864) | 42489..43280 | - | 792 | WP_008322208.1 | site-specific integrase | - |
| LQ176_RS25050 (AI2826V1_4865) | 43270..43584 | - | 315 | WP_008322211.1 | hypothetical protein | - |
| LQ176_RS25055 (AI2826V1_4866) | 43586..43891 | - | 306 | WP_008322213.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| LQ176_RS25060 (AI2826V1_4867) | 43893..44111 | - | 219 | WP_032934863.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| LQ176_RS25065 (AI2826V1_4868) | 44823..45797 | - | 975 | WP_181219984.1 | sensor domain-containing diguanylate cyclase | - |
| LQ176_RS25080 (AI2826V1_4873) | 47911..48540 | - | 630 | WP_181219980.1 | IS6 family transposase | - |
| LQ176_RS25085 (AI2826V1_4874) | 48531..49043 | + | 513 | WP_230133460.1 | DM13 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..112775 | 112775 | |
| - | inside | IScluster/Tn | - | - | 45944..66972 | 21028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11450.23 Da Isoelectric Point: 5.8211
>T295786 WP_008322213.1 NZ_OW967264:c43891-43586 [Citrobacter freundii]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE27 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE25 |