Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 4737573..4738239 | Replicon | chromosome |
| Accession | NZ_OW967263 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | A0A0D7LIM5 |
| Locus tag | LQ176_RS23130 | Protein ID | WP_044702260.1 |
| Coordinates | 4737880..4738239 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | A0A0D7LIR0 |
| Locus tag | LQ176_RS23125 | Protein ID | WP_003844682.1 |
| Coordinates | 4737573..4737890 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ176_RS23095 (4733240) | 4733240..4734064 | + | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| LQ176_RS23100 (4734133) | 4734133..4735356 | + | 1224 | WP_044702265.1 | L-sorbose 1-phosphate reductase | - |
| LQ176_RS23105 (4735358) | 4735358..4736170 | + | 813 | WP_044702264.1 | shikimate 5-dehydrogenase | - |
| LQ176_RS23110 (4736222) | 4736222..4736578 | - | 357 | WP_032948294.1 | hypothetical protein | - |
| LQ176_RS23115 (4736720) | 4736720..4736881 | + | 162 | WP_003841416.1 | phage protein | - |
| LQ176_RS23120 (4737285) | 4737285..4737563 | + | 279 | WP_044702262.1 | putative addiction module antidote protein | - |
| LQ176_RS23125 (4737573) | 4737573..4737890 | - | 318 | WP_003844682.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LQ176_RS23130 (4737880) | 4737880..4738239 | - | 360 | WP_044702260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ176_RS23135 (4738453) | 4738453..4739142 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
| LQ176_RS23140 (4739208) | 4739208..4740839 | - | 1632 | WP_032938230.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13437.49 Da Isoelectric Point: 10.2555
>T295784 WP_044702260.1 NZ_OW967263:c4738239-4737880 [Citrobacter freundii]
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LIM5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LIR0 |