Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4510822..4511338 | Replicon | chromosome |
| Accession | NZ_OW967263 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LQ176_RS22060 | Protein ID | WP_044699148.1 |
| Coordinates | 4510822..4511106 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0J1MV10 |
| Locus tag | LQ176_RS22065 | Protein ID | WP_003839576.1 |
| Coordinates | 4511096..4511338 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ176_RS22045 (4507147) | 4507147..4507731 | + | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
| LQ176_RS22050 (4508109) | 4508109..4510247 | + | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LQ176_RS22055 (4510354) | 4510354..4510818 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LQ176_RS22060 (4510822) | 4510822..4511106 | - | 285 | WP_044699148.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ176_RS22065 (4511096) | 4511096..4511338 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LQ176_RS22070 (4511416) | 4511416..4513329 | - | 1914 | WP_003839574.1 | BglG family transcription antiterminator | - |
| LQ176_RS22075 (4513351) | 4513351..4514091 | - | 741 | WP_044699149.1 | KDGP aldolase family protein | - |
| LQ176_RS22080 (4514088) | 4514088..4515206 | - | 1119 | WP_044699152.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| LQ176_RS22085 (4515190) | 4515190..4516323 | - | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10865.69 Da Isoelectric Point: 10.1988
>T295783 WP_044699148.1 NZ_OW967263:c4511106-4510822 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|