Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 4027453..4028132 | Replicon | chromosome |
Accession | NZ_OW967263 | ||
Organism | Citrobacter freundii isolate 22 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
Locus tag | LQ176_RS19710 | Protein ID | WP_003031349.1 |
Coordinates | 4027791..4028132 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
Locus tag | LQ176_RS19705 | Protein ID | WP_003031347.1 |
Coordinates | 4027453..4027770 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ176_RS19680 (4023546) | 4023546..4025543 | - | 1998 | WP_016245729.1 | choline BCCT transporter BetT | - |
LQ176_RS19685 (4026091) | 4026091..4026238 | + | 148 | Protein_3866 | hypothetical protein | - |
LQ176_RS19690 (4026252) | 4026252..4026713 | + | 462 | WP_003031344.1 | antirestriction protein | - |
LQ176_RS19695 (4026729) | 4026729..4027205 | + | 477 | WP_003031345.1 | RadC family protein | - |
LQ176_RS19700 (4027214) | 4027214..4027435 | + | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
LQ176_RS19705 (4027453) | 4027453..4027770 | + | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ176_RS19710 (4027791) | 4027791..4028132 | + | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
LQ176_RS19715 (4028722) | 4028722..4029324 | - | 603 | WP_230133428.1 | tail fiber assembly protein | - |
LQ176_RS19720 (4029326) | 4029326..4030627 | - | 1302 | WP_230133429.1 | hypothetical protein | - |
LQ176_RS19725 (4030627) | 4030627..4031307 | - | 681 | WP_044702567.1 | DUF2612 domain-containing protein | - |
LQ176_RS19730 (4031304) | 4031304..4032503 | - | 1200 | WP_044702568.1 | baseplate J/gp47 family protein | - |
LQ176_RS19735 (4032504) | 4032504..4032857 | - | 354 | WP_016239889.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4026252..4077711 | 51459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T295782 WP_003031349.1 NZ_OW967263:4027791-4028132 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLJ2 |