Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3791799..3792419 | Replicon | chromosome |
| Accession | NZ_OW967263 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | LQ176_RS18610 | Protein ID | WP_002892050.1 |
| Coordinates | 3792201..3792419 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | LQ176_RS18605 | Protein ID | WP_003021733.1 |
| Coordinates | 3791799..3792173 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ176_RS18595 (3786946) | 3786946..3788139 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ176_RS18600 (3788162) | 3788162..3791311 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| LQ176_RS18605 (3791799) | 3791799..3792173 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ176_RS18610 (3792201) | 3792201..3792419 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| LQ176_RS18615 (3792726) | 3792726..3793277 | + | 552 | WP_044699372.1 | maltose O-acetyltransferase | - |
| LQ176_RS18620 (3793394) | 3793394..3793864 | + | 471 | WP_003021724.1 | YlaC family protein | - |
| LQ176_RS18625 (3793943) | 3793943..3794083 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| LQ176_RS18630 (3794085) | 3794085..3794345 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
| LQ176_RS18635 (3794534) | 3794534..3796087 | + | 1554 | WP_044699371.1 | EAL domain-containing protein | - |
| LQ176_RS18640 (3796139) | 3796139..3796492 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| LQ176_RS18645 (3796557) | 3796557..3797186 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295781 WP_002892050.1 NZ_OW967263:3792201-3792419 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT295781 WP_003021733.1 NZ_OW967263:3791799-3792173 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |