Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 852731..853385 | Replicon | chromosome |
| Accession | NZ_OW967263 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | LQ176_RS04155 | Protein ID | WP_003026936.1 |
| Coordinates | 852978..853385 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | LQ176_RS04150 | Protein ID | WP_003026938.1 |
| Coordinates | 852731..852997 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ176_RS04125 (847932) | 847932..849365 | - | 1434 | WP_044700805.1 | 6-phospho-beta-glucosidase BglA | - |
| LQ176_RS04130 (849486) | 849486..850214 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| LQ176_RS04135 (850267) | 850267..850578 | + | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ176_RS04140 (850741) | 850741..851400 | + | 660 | WP_003838267.1 | hemolysin III family protein | - |
| LQ176_RS04145 (851494) | 851494..852474 | - | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
| LQ176_RS04150 (852731) | 852731..852997 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| LQ176_RS04155 (852978) | 852978..853385 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
| LQ176_RS04160 (853430) | 853430..853951 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
| LQ176_RS04165 (854065) | 854065..854961 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
| LQ176_RS04170 (854985) | 854985..855698 | + | 714 | WP_003026923.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ176_RS04175 (855704) | 855704..857437 | + | 1734 | WP_044700800.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T295776 WP_003026936.1 NZ_OW967263:852978-853385 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |