Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 4467..5160 | Replicon | plasmid P1 |
| Accession | NZ_OW967179 | ||
| Organism | Escherichia coli isolate 362 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | LQ124_RS23120 | Protein ID | WP_000182276.1 |
| Coordinates | 4804..5160 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | LQ124_RS23115 | Protein ID | WP_001172026.1 |
| Coordinates | 4467..4802 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ124_RS23090 (AI2821V1_4423) | 1..1056 | + | 1056 | WP_015060006.1 | plasmid replication initiator RepA | - |
| LQ124_RS23095 (AI2821V1_4424) | 2013..3233 | - | 1221 | WP_230133249.1 | HD-GYP domain-containing protein | - |
| LQ124_RS23100 (AI2821V1_4425) | 3390..3770 | - | 381 | WP_001054412.1 | hypothetical protein | - |
| LQ124_RS23105 (AI2821V1_4426) | 3767..4093 | - | 327 | WP_000091614.1 | hypothetical protein | - |
| LQ124_RS23110 (AI2821V1_4427) | 4117..4452 | - | 336 | WP_000741275.1 | hypothetical protein | - |
| LQ124_RS23115 (AI2821V1_4428) | 4467..4802 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LQ124_RS23120 (AI2821V1_4429) | 4804..5160 | - | 357 | WP_000182276.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ124_RS23125 (AI2821V1_4430) | 5352..5954 | + | 603 | WP_010465829.1 | recombinase family protein | - |
| LQ124_RS23130 (AI2821V1_4431) | 5938..8967 | + | 3030 | WP_032432545.1 | Tn3 family transposase | - |
| LQ124_RS23615 | 9438..9533 | + | 96 | WP_004206884.1 | DinQ-like type I toxin DqlB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-48 | - | 1..70748 | 70748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12912.93 Da Isoelectric Point: 8.9018
>T295772 WP_000182276.1 NZ_OW967179:c5160-4804 [Escherichia coli]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLKVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQEL
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLKVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQEL
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|