Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4284231..4284826 | Replicon | chromosome |
Accession | NZ_OW967178 | ||
Organism | Escherichia coli isolate 362 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | LQ124_RS20385 | Protein ID | WP_000239581.1 |
Coordinates | 4284231..4284581 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | LQ124_RS20390 | Protein ID | WP_001223213.1 |
Coordinates | 4284575..4284826 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ124_RS20365 (4279676) | 4279676..4280698 | - | 1023 | WP_001316039.1 | ABC transporter permease | - |
LQ124_RS20370 (4280712) | 4280712..4282214 | - | 1503 | WP_230133213.1 | sugar ABC transporter ATP-binding protein | - |
LQ124_RS20375 (4282347) | 4282347..4283312 | - | 966 | WP_001589575.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
LQ124_RS20380 (4283622) | 4283622..4284152 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
LQ124_RS20385 (4284231) | 4284231..4284581 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
LQ124_RS20390 (4284575) | 4284575..4284826 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
LQ124_RS20395 (4285038) | 4285038..4285379 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
LQ124_RS20400 (4285382) | 4285382..4289161 | - | 3780 | WP_001589573.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T295769 WP_000239581.1 NZ_OW967178:c4284581-4284231 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|