Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3581693..3582311 | Replicon | chromosome |
| Accession | NZ_OW967178 | ||
| Organism | Escherichia coli isolate 362 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | LQ124_RS17105 | Protein ID | WP_001291435.1 |
| Coordinates | 3582093..3582311 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | LQ124_RS17100 | Protein ID | WP_000344800.1 |
| Coordinates | 3581693..3582067 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ124_RS17090 (3576782) | 3576782..3577975 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ124_RS17095 (3577998) | 3577998..3581147 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| LQ124_RS17100 (3581693) | 3581693..3582067 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ124_RS17105 (3582093) | 3582093..3582311 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| LQ124_RS17110 (3582483) | 3582483..3583034 | + | 552 | WP_001589809.1 | maltose O-acetyltransferase | - |
| LQ124_RS17115 (3583151) | 3583151..3583621 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| LQ124_RS17120 (3583785) | 3583785..3585335 | + | 1551 | WP_001389864.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| LQ124_RS17125 (3585377) | 3585377..3585730 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| LQ124_RS17135 (3586109) | 3586109..3586420 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| LQ124_RS17140 (3586451) | 3586451..3587023 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295766 WP_001291435.1 NZ_OW967178:3582093-3582311 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT295766 WP_000344800.1 NZ_OW967178:3581693-3582067 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |