Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3180739..3181444 | Replicon | chromosome |
| Accession | NZ_OW967178 | ||
| Organism | Escherichia coli isolate 362 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | LQ124_RS15305 | Protein ID | WP_000539521.1 |
| Coordinates | 3180739..3181125 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LQ124_RS15310 | Protein ID | WP_001280945.1 |
| Coordinates | 3181115..3181444 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ124_RS15285 (3176743) | 3176743..3177369 | + | 627 | WP_001328219.1 | glutathione S-transferase GstB | - |
| LQ124_RS15290 (3177366) | 3177366..3178481 | - | 1116 | WP_000555049.1 | aldose sugar dehydrogenase YliI | - |
| LQ124_RS15295 (3178592) | 3178592..3178975 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| LQ124_RS15300 (3179188) | 3179188..3180513 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| LQ124_RS15305 (3180739) | 3180739..3181125 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ124_RS15310 (3181115) | 3181115..3181444 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| LQ124_RS15315 (3181514) | 3181514..3182842 | - | 1329 | WP_000086868.1 | GGDEF domain-containing protein | - |
| LQ124_RS15320 (3182850) | 3182850..3185198 | - | 2349 | WP_001328220.1 | EAL domain-containing protein | - |
| LQ124_RS15325 (3185376) | 3185376..3186287 | - | 912 | WP_001236018.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T295765 WP_000539521.1 NZ_OW967178:3180739-3181125 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|