Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2473797..2474435 | Replicon | chromosome |
Accession | NZ_OW967178 | ||
Organism | Escherichia coli isolate 362 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | B7N4J4 |
Locus tag | LQ124_RS11885 | Protein ID | WP_000813797.1 |
Coordinates | 2473797..2473973 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LQ124_RS11890 | Protein ID | WP_001270286.1 |
Coordinates | 2474019..2474435 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ124_RS11865 (2469419) | 2469419..2470591 | - | 1173 | WP_001236217.1 | BenE family transporter YdcO | - |
LQ124_RS11870 (2470683) | 2470683..2471219 | + | 537 | WP_000429505.1 | DNA-binding transcriptional regulator SutR | - |
LQ124_RS11875 (2471292) | 2471292..2473253 | + | 1962 | WP_001445698.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
LQ124_RS11880 (2473345) | 2473345..2473575 | - | 231 | WP_000491976.1 | YncJ family protein | - |
LQ124_RS11885 (2473797) | 2473797..2473973 | + | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
LQ124_RS11890 (2474019) | 2474019..2474435 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
LQ124_RS11895 (2474514) | 2474514..2475920 | + | 1407 | WP_000760596.1 | PLP-dependent aminotransferase family protein | - |
LQ124_RS11900 (2476165) | 2476165..2477310 | + | 1146 | WP_000047452.1 | ABC transporter substrate-binding protein | - |
LQ124_RS11905 (2477328) | 2477328..2478341 | + | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
LQ124_RS11910 (2478342) | 2478342..2479283 | + | 942 | WP_001578312.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T295763 WP_000813797.1 NZ_OW967178:2473797-2473973 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT295763 WP_001270286.1 NZ_OW967178:2474019-2474435 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|