Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 905251..905905 | Replicon | chromosome |
Accession | NZ_OW967178 | ||
Organism | Escherichia coli isolate 362 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | LQ124_RS04300 | Protein ID | WP_000244781.1 |
Coordinates | 905498..905905 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | LQ124_RS04295 | Protein ID | WP_000354046.1 |
Coordinates | 905251..905517 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ124_RS04275 (901339) | 901339..902772 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
LQ124_RS04280 (902817) | 902817..903128 | + | 312 | WP_001182952.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ124_RS04285 (903292) | 903292..903951 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
LQ124_RS04290 (904028) | 904028..905008 | - | 981 | WP_001578935.1 | tRNA-modifying protein YgfZ | - |
LQ124_RS04295 (905251) | 905251..905517 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
LQ124_RS04300 (905498) | 905498..905905 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
LQ124_RS04305 (905945) | 905945..906466 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
LQ124_RS04310 (906578) | 906578..907474 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
LQ124_RS04315 (907499) | 907499..908209 | + | 711 | WP_000715221.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ124_RS04320 (908215) | 908215..909948 | + | 1734 | WP_001590643.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T295756 WP_000244781.1 NZ_OW967178:905498-905905 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|